PDB entry 2rre

View 2rre on RCSB PDB site
Description: structure and function of the n-terminal nucleolin binding domain of nuclear valocine containing protein like 2 (nvl2) harboring a nucleolar localization signal
Deposited on 2010-08-03, released 2011-04-06
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rreA (A:)
    gsdhmkprpgvfvdrklkqrviqylssnrcgkyvdtgilasdlqrlysvdygrrkrnafr
    iqvekvfsiissekelkn
    

    Sequence, based on observed residues (ATOM records):
    >2rreA (A:)
    mkprpgvfvdrklkqrviqylssnrcgkyvdtgilasdlqrlysvdygrrkrnafriqve
    kvfsiissekelkn