PDB entry 2rr6

View 2rr6 on RCSB PDB site
Description: Solution structure of the leucine rich repeat of human acidic leucine-rich nuclear phosphoprotein 32 family member B
Deposited on 2010-05-25, released 2010-06-09
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acidic leucine-rich nuclear phosphoprotein 32 family member B
    Species: Homo sapiens [TaxId:9606]
    Gene: ANP32B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92688 (7-167)
      • expression tag (0-6)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rr6A (A:)
gssgssgmdmkrrihlelrnrtpaavrelvldncksndgkiegltaefvnleflslinvg
lisvsnlpklpklkklelsenrifggldmlaeklpnlthlnlsgnklkdistleplkkle
clksldlfncevtnlndyresvfkllpqltyldgydredqeapdsdae