PDB entry 2rr2

View 2rr2 on RCSB PDB site
Description: structure of o-fucosylated epidermal growth factor-like repeat 12 of mouse notch-1 receptor
Deposited on 2010-02-26, released 2010-10-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FUC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rr2A (A:)
    dvnecisnpcqndatcldqigefqcicmpgyegvycei