PDB entry 2rr0

View 2rr0 on RCSB PDB site
Description: Structure of epidermal growth factor-like repeat 12 of mouse Notch-1 receptor
Deposited on 2010-02-26, released 2010-10-13
The last revision was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rr0A (A:)
    dvnecisnpcqndatcldqigefqcicmpgyegvycei