PDB entry 2rqx

View 2rqx on RCSB PDB site
Description: Solution NMR structure of PMRD from klebsiella pneumoniae
Deposited on 2010-01-14, released 2010-12-01
The last revision was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymyxin B resistance protein
    Species: Klebsiella pneumoniae [TaxId:484021]
    Gene: pmrD, KP1_3573
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rqxA (A:)
mewwvkkvqdnasaslcrvvlqsgalemiaeieacrlrlregdkltpladaryclnnnpt
qtlkirnathysserwtnadklehhhhhh

    Sequence, based on observed residues (ATOM records):
    >2rqxA (A:)
mewwvkkvqdnasaslcrvvlqsgalemiaeieacrlrlregdkltpladaryclnnnpt
qtlkirnathysserwtnadk