PDB entry 2rqw

View 2rqw on RCSB PDB site
Description: Solution structure of Bem1p SH3CI domain complexed with Ste20p-PRR peptide
Deposited on 2009-12-21, released 2010-04-21
The last revision was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bud emergence protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 24-meric peptide from Serine/threonine-protein kinase STE20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rqwA (A:)
    gslyaivlydfkaekadelttyvgenlficahhncewfiakpigrlggpglvpvgfvsii
    diatgyatgndviediksvnlptvqewksniarykasnislgsve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2rqwB (B:)
    sssangkfipsrpapkppssasas