PDB entry 2rqu

View 2rqu on RCSB PDB site
Description: Solution structure of the complex between the DDEF1 SH3 domain and the APC SAMP1 motif
Class: signaling protein
Keywords: SH3 domain, GAP, SAMP motif, Tumor suppressor, Cell junction, Disease mutation, Phosphoprotein, Wnt signaling pathway, SIGNALING PROTEIN
Deposited on 2009-12-14, released 2010-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ddef1_sh3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rqua_
  • Chain 'B':
    Compound: 19-mer from Adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APC, DP2.5
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rquA (A:)
    vrrvktiydcqadnddeltfiegeviivtgeedqewwighiegqperkgvfpvsfvhils
    d
    

  • Chain 'B':
    No sequence available.