PDB entry 2rqt

View 2rqt on RCSB PDB site
Description: Solution structure of the human DDEF1 SH3 domain
Class: signaling protein
Keywords: SH3 domain, GAP, GTPase activation, Membrane, SIGNALING PROTEIN
Deposited on 2009-12-14, released 2010-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASAP1, DDEF1, KIAA1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rqta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rqtA (A:)
    vrrvktiydcqadnddeltfiegeviivtgeedqewwighiegqperkgvfpvsfvhils
    d