PDB entry 2rqs

View 2rqs on RCSB PDB site
Description: 3D structure of Pin from the psychrophilic archeon Cenarcheaum symbiosum (CsPin)
Class: Isomerase
Keywords: cis/trans isomerisation, Cenarcheaum symbiosum, low temperature, NIMA-kinase, parvulin, Pin1, cell cycle, Isomerase
Deposited on 2009-11-17, released 2010-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Parvulin-like peptidyl-prolyl isomerase
  Species: Cenarchaeum symbiosum [TaxId:46770]
  Gene: pinA
  Database cross-references and differences (RAF-indexed):
  • Uniprot O74049 (5-96)
    • expression tag (0-4)
  Domains in SCOPe 2.08: d2rqsa1, d2rqsa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rqsA (A:)
  gpmgsmadkikcshilvkkqgealavqerlkagekfgklakelsidggsakrdgslgyfg
  rgkmvkpfedaafrlqvgevsepvksefgyhvikrlg