PDB entry 2rqr

View 2rqr on RCSB PDB site
Description: the solution structure of human dock2 sh3 domain - elmo1 peptide chimera complex
Deposited on 2009-10-21, released 2010-10-27
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Engulfment and cell motility protein 1,Dedicator of cytokinesis protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DOCK2, KIAA0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92556 (7-32)
      • expression tag (0-6)
      • linker (33-55)
    • Uniprot Q92608 (56-118)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rqrA (A:)
gssgssgrlldleniqipdapppipkepsnydfsgpssgiegrgssgssgssgssgdker
hgvaiynfqgsgapqlslqigdvvriqetcgdwyrgylikhkmlqgifpksfihikevt