PDB entry 2rqp

View 2rqp on RCSB PDB site
Description: The Solution Structure of Heterochromatin Protein 1-Binding Protein 74 Histone H1 like domain
Class: Gene Regulation
Keywords: heterochromatin protein 1 binding protein, histone H1, heterochromatin protein 1, Alternative splicing, Chromosomal protein, DNA-binding, Nucleus, Phosphoprotein, Gene Regulation
Deposited on 2009-09-04, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Heterochromatin protein 1-binding protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: HP1BP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SSJ5 (3-87)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2rqpa1, d2rqpa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rqpA (A:)
  gpgmassprpkmdailteaikacfqksgasvvairkyiihkypslelerrgyllkqalkr
  elnrgvikqvkgkgasgsfvvvqksrkt