PDB entry 2rqm

View 2rqm on RCSB PDB site
Description: NMR Solution Structure of Mesoderm Development (MESD) - open conformation
Deposited on 2009-08-14, released 2009-08-25
The last revision was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mesoderm development candidate 2
    Species: Mus musculus [TaxId:10090]
    Gene: Mesdc2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ERE7 (1-140)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rqmA (A:)
    gdirdyndadmarlleqwekdddieegdlpehkrpsapidfskldpgkpesilkmtkkgk
    tlmmfvtvsgnpteketeeitslwqgslfnanydvqrfivgsdraifmlrdgsyaweikd
    flvsqdrcaevtlegqmypgk