PDB entry 2rql

View 2rql on RCSB PDB site
Description: Solution structure of the E. coli ribosome hibernation promoting factor HPF
Class: translation
Keywords: ribosome hibernation promoting factor, HPF, ribosome, TRANSLATION
Deposited on 2009-08-13, released 2010-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable sigma-54 modulation protein
  Species: Escherichia coli [TaxId:562]
  Gene: hpf, ECs4082
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2KHI5 (0-94)
  Domains in SCOPe 2.04: d2rqla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rqlA (A:)
  mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
  ihasaegqdmyaaidglidklarqltkhkdklkqh