PDB entry 2rql

View 2rql on RCSB PDB site
Description: Solution structure of the E. coli ribosome hibernation promoting factor HPF
Class: translation
Keywords: ribosome hibernation promoting factor, HPF, ribosome, TRANSLATION
Deposited on 2009-08-13, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable sigma-54 modulation protein
    Species: Escherichia coli [TaxId:562]
    Gene: hpf, ECs4082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rqla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rqlA (A:)
    mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
    ihasaegqdmyaaidglidklarqltkhkdklkqh