PDB entry 2rqh

View 2rqh on RCSB PDB site
Description: Structure of GSPT1/ERF3A-PABC
Class: protein binding
Keywords: PROTEIN-PROTEIN COMPLEX, GTP-binding, Nucleotide-binding, Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, PROTEIN BINDING
Deposited on 2009-05-08, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G1 to S phase transition 1
    Species: Mus musculus [TaxId:10090]
    Gene: Gspt1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPC1, PAB1, PABP1, PABPC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rqhb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rqhB (B:)
    gqepltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlesp
    eslrskvdeavavlqahqakeaa