PDB entry 2rqf

View 2rqf on RCSB PDB site
Description: Solution structure of juvenile hormone binding protein from silkworm in complex with JH III
Deposited on 2009-04-27, released 2010-05-05
The last revision was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolymph juvenile hormone binding protein
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U556 (2-226)
      • expression tag (0-1)
  • Heterogens: JH3

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rqfA (A:)
gsdgdallkpcklgdmqclssateqflektskgipqydiwpidplvvtsldviapsdagi
virfknlnitglknqqisdfqmdtkaktvllktkadlhivgdivielteqsksftglyta
dtnvigavrygynlknddngvqhfevqpetftcesigepkitlssdlssalekdsgnnsl
epdmeplktlrqaaickiaeacyisvvhnirasakilpassffenln