PDB entry 2rq9

View 2rq9 on RCSB PDB site
Description: Solution structure of human acidic fibroblast growth factor (aFGF) in the presence of a protein stabilizer NDSB-new
Class: protein binding
Keywords: beta-Trefoil, Acetylation, Alternative splicing, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, PROTEIN BINDING
Deposited on 2009-03-12, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (1-134)
      • expression tag (0)
      • expression tag (135-142)
    Domains in SCOPe 2.07: d2rq9a1, d2rq9a2, d2rq9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rq9A (A:)
    mnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssdlehhhhhh