PDB entry 2rq8

View 2rq8 on RCSB PDB site
Description: Solution NMR structure of titin I27 domain mutant
Class: transferase
Keywords: Beta-sandwich, Immunoglobulin-like domain, Alternative splicing, ATP-binding, Calcium, Calmodulin-binding, Cardiomyopathy, Coiled coil, Cytoplasm, Disease mutation, Disulfide bond, Immunoglobulin domain, Isopeptide bond, Kelch repeat, Kinase, Limb-girdle muscular dystrophy, Magnesium, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, TPR repeat, Transferase, Ubl conjugation, WD repeat
Deposited on 2009-03-05, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (1-89)
      • expression tag (0)
      • engineered (3)
      • engineered (9)
      • engineered (42)
      • engineered (78)
      • expression tag (90-97)
    Domains in SCOPe 2.08: d2rq8a1, d2rq8a2, d2rq8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rq8A (A:)
    mlievekplpgvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkhili
    lhncqlgmtgevsfqaantksaanlkvkellehhhhhh