PDB entry 2rq4

View 2rq4 on RCSB PDB site
Description: Refinement of RNA binding domain 3 in CUG triplet repeat RNA-binding protein 1
Class: transcription
Keywords: RRM domain, RBD, Activator, Alternative splicing, Cytoplasm, mRNA processing, Nucleus, Phosphoprotein, RNA-binding, TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2009-01-19, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUG-BP- and ETR-3-like factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CUGBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92879 (7-108)
      • expression tag (0-6)
      • expression tag (109-114)
    Domains in SCOPe 2.08: d2rq4a1, d2rq4a2, d2rq4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rq4A (A:)
    gssgssgltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfid
    kqtnlskcfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsksgpssg