PDB entry 2rq0

View 2rq0 on RCSB PDB site
Description: Solution Structure of Mouse Lipocalin-type Prostaglandin D Synthase Possessing the Intrinsic Disulfide Bond
Class: isomerase
Keywords: Lipocalin, beta-barrel, Cytoplasm, Endoplasmic reticulum, Fatty acid biosynthesis, Glycoprotein, Golgi apparatus, Isomerase, Lipid synthesis, Membrane, Nucleus, Prostaglandin biosynthesis, Pyrrolidone carboxylic acid, Secreted, Transport
Deposited on 2008-12-24, released 2009-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Prostaglandin-H2 D-isomerase
  Species: Mus musculus [TaxId:10090]
  Gene: Ptgds
  Database cross-references and differences (RAF-indexed):
  • Uniprot O09114 (2-166)
    • expression tag (0-1)
    • engineered (42)
  Domains in SCOPe 2.08: d2rq0a1, d2rq0a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rq0A (A:)
  gsqghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltst
  flrknqcetkimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqd
  frmatlysrtqtlkdelkekfttfskaqglteedivflpqpdkciqe