PDB entry 2rpq

View 2rpq on RCSB PDB site
Description: Solution Structure of a SUMO-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
Class: transcription
Keywords: SUMO, SIM, Nucleus, Ubl conjugation, Ubl conjugation pathway, Activator, Alternative splicing, Coiled coil, Host-virus interaction, Phosphoprotein, Polymorphism, Repressor, Transcription, Transcription regulation
Deposited on 2008-07-07, released 2008-10-07
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-07, with a file datestamp of 2008-10-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61956 (0-92)
  Domains in SCOP 1.75: d2rpqa1
• Chain 'B':
  Compound: Activating transcription factor 7-interacting protein 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6VMQ6

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rpqA (A:)
  madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
  rfdgqpinetdtpaqlemededtidvfqqqtgg
  

  
  
• Chain 'B':
  No sequence available.