PDB entry 2rpq

View 2rpq on RCSB PDB site
Description: Solution Structure of a SUMO-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
Class: transcription
Keywords: SUMO, SIM, Nucleus, Ubl conjugation pathway, Activator, Host-virus interaction, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on 2008-07-07, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rpqa1
  • Chain 'B':
    Compound: Activating transcription factor 7-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rpqA (A:)
    madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
    rfdgqpinetdtpaqlemededtidvfqqqtgg
    

  • Chain 'B':
    No sequence available.