PDB entry 2roz

View 2roz on RCSB PDB site
Description: Structure of the C-terminal PID Domain of Fe65L1 Complexed with the Cytoplasmic Tail of APP Reveals a Novel Peptide Binding Mode
Class: peptide binding protein
Keywords: Fe65L1, PID domain, amyloid precursor protein, Alternative splicing, Amyloid, Apoptosis, Cell adhesion, Coated pit, Copper, Endocytosis, Glycoprotein, Heparin-binding, Iron, Membrane, Metal-binding, Notch signaling pathway, Phosphoprotein, Protease inhibitor, Serine protease inhibitor, Transmembrane, Zinc, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PEPTIDE BINDING PROTEIN
Deposited on 2008-04-25, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide from Amyloid beta A4 protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Amyloid beta A4 precursor protein-binding family B member 2
    Species: Mus musculus [TaxId:10090]
    Gene: Apbb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DBR4 (7-129)
      • expression tag (0-6)
      • expression tag (130-135)
    Domains in SCOPe 2.08: d2rozb1, d2rozb2, d2rozb3

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rozB (B:)
    gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
    adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
    nvseavqaacsgpssg