PDB entry 2roy

View 2roy on RCSB PDB site
Description: transthyretin (also called prealbumin) complex with 3',5'-dinitro-n-acetyl-l-thyronine
Class: transport
Keywords: albumin, transport, retinol-binding, vitamin a, amyloid, thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, disease mutation, thyroxine, prealbumin
Deposited on 1996-10-23, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2roya_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2royb_
  • Heterogens: P28, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2royA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2royA (A:)
    eskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefve
    giykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpk
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2royB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2royB (B:)
    eskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefve
    giykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp