PDB entry 2ron

View 2ron on RCSB PDB site
Description: the external thioesterase of the surfactin-synthetase
Deposited on 2008-04-04, released 2008-08-12
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Surfactin synthetase thioesterase subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: srfAD
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ronA (A:)
    msqlfksfdasektqlicfpfaggysasfrplhaflqgecemlaaeppghgtnqtsaied
    leeltdlykqelnlrpdrpfvlfghsmggmitfrlaqkleregifpqaviisaiqpphiq
    rkkvshlpddqfldhiiqlggmpaelvenkevmsfflpsfrsdyraleqfelydlaqiqs
    pvhvfnglddkkcirdaegwkkwakditfhqfdgghmfllsqteevaerifailnqhpii
    qp