PDB entry 2rol

View 2rol on RCSB PDB site
Description: structural basis of pxxdy motif recognition in sh3 binding
Deposited on 2008-04-02, released 2009-03-03
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor kinase substrate 8-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPS8L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TE68 (4-63)
      • expression tag (0-3)
  • Chain 'B':
    Compound: 12-meric peptide from T-cell surface glycoprotein CD3 epsilon chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rolA (A:)
gsmgtagkwvlcnydfqarnsselsvkqrdvlevlddsrkwwkvrdpagqegyvpynilt
pypg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2rolB (B:)
ppvpnpdyepir