PDB entry 2rok

View 2rok on RCSB PDB site
Description: Solution structure of the cap-binding domain of PARN complexed with the cap analog
Class: RNA binding protein
Keywords: RRM, RBD, CAP, Structural Genomics, RNA BINDING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2008-03-28, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(A)-specific Ribonuclease
    Species: Mus musculus [TaxId:10090]
    Gene: PARN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TUQ8 (7-93)
      • expression tag (0-6)
      • expression tag (94-99)
    Domains in SCOPe 2.06: d2roka1, d2roka2, d2roka3
  • Heterogens: 7MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rokA (A:)
    gssgssggpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpe
    qvqiavntskyaesyriqtyaeyvgkkqkgkqvksgpssg