PDB entry 2roh

View 2roh on RCSB PDB site
Description: the dna binding domain of rtbp1
Deposited on 2008-03-22, released 2009-03-24
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere binding protein-1
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LL45 (2-111)
      • expression tag (0-1)
      • expression tag (112-121)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rohA (A:)
gspfadpnslalanvplsrskrpdfgqrrirrpftvaevellveavehlgtgrwrdvkfr
afenvhhrtyvdlkdkwktlvhtasiapqqrrgapvpqelldrvlaaqaywsvdssgriv
tl