PDB entry 2rog

View 2rog on RCSB PDB site
Description: Solution structure of Thermus thermophilus HB8 TTHA1718 protein in living E. coli cells
Class: metal binding protein
Keywords: protein, METAL BINDING PROTEIN
Deposited on 2008-03-21, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Heavy metal binding protein
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHL2 (0-65)
  Domains in SCOPe 2.06: d2roga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rogA (A:)
  mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy
  kaevla