PDB entry 2roc

View 2roc on RCSB PDB site
Description: Solution structure of Mcl-1 Complexed with Puma
Class: Apoptosis
Keywords: Mcl-1, Bcl-2, apoptosis, Puma, BH3-only, Cytoplasm, Developmental protein, Differentiation, Membrane, Mitochondrion, Nucleus, Phosphoprotein, Transmembrane, Ubl conjugation
Deposited on 2008-03-17, released 2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
    Species: MUS MUSCULUS
    Gene: mcl-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97287 (5-161)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2roca2, d2roca3
  • Chain 'B':
    Compound: Bcl-2-binding component 3
    Species: MUS MUSCULUS
    Gene: Puma
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99ML1 (0-25)
      • engineered (14)
      • expression tag (26)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rocA (A:)
    gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
    tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
    fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg
    

  • Chain 'B':
    No sequence available.