PDB entry 2ro9

View 2ro9 on RCSB PDB site
Description: Solution structure of calcium bound soybean calmodulin isoform 1 C-terminal domain
Class: metal binding protein
Keywords: soybean calmodulin, plant calmodulin, calmodulin isoform, target binding, target activation, Acetylation, Calcium, Methylation, METAL BINDING PROTEIN
Deposited on 2008-03-14, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Calmodulin-2
  Species: Glycine max [TaxId:3847]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62163 (0-68)
  Domains in SCOPe 2.08: d2ro9a_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ro9A (A:)
  dseeelkeafrvfdkdqngfisaaelrhvmtnlgekltdeevdemireadvdgdgqinye
  efvkvmmak