PDB entry 2ro4

View 2ro4 on RCSB PDB site
Description: RDC-refined Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator AbrB
Class: Transcription
Keywords: Transcription, Activator, DNA-binding, Repressor, Sporulation, Transcription regulation
Deposited on 2008-03-08, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transition state regulatory protein abrB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ABRB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08874 (0-52)
  Domains in SCOPe 2.08: d2ro4a_
• Chain 'B':
  Compound: Transition state regulatory protein abrB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ABRB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08874 (0-52)
  Domains in SCOPe 2.08: d2ro4b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ro4A (A:)
  mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ro4B (B:)
  mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt