PDB entry 2ro3

View 2ro3 on RCSB PDB site
Description: RDC-refined Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator Abh
Class: Transcription
Keywords: Transcription, DNA-binding, Transcription regulation
Deposited on 2008-03-08, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transition state regulator abh
    Species: Bacillus subtilis [TaxId:1423]
    Gene: abh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ro3a_
  • Chain 'B':
    Compound: Putative transition state regulator abh
    Species: Bacillus subtilis [TaxId:1423]
    Gene: abh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ro3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ro3A (A:)
    mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ro3B (B:)
    mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc