PDB entry 2rnz

View 2rnz on RCSB PDB site
Description: solution structure of the presumed chromodomain of the yeast histone acetyltransferase, esa1
Deposited on 2008-03-01, released 2008-04-29
The last revision was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08649 (21-93)
      • expression tag (0-20)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rnzA (A:)
    mgsshhhhhhssglvprgshmsvddiiikcqcwvqkndeerlaeilsintrkappkfyvh
    yvnynkrldewittdrinldkevlypklkatded