PDB entry 2rnt

View 2rnt on RCSB PDB site
Description: three-dimensional structure of ribonuclease t1 complexed with guanylyl-2(prime),5(prime)-guanosine at 1.8 angstroms resolution
Deposited on 1988-07-06, released 1989-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2rnt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rnt_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect