PDB entry 2rnr

View 2rnr on RCSB PDB site
Description: Solution structure of the complex between TFIIE alpha C-terminal acidic domain and TFIIH p62 PH domain
Class: transcription
Keywords: general transcription factor, human TFIIE alpha, human TFIIH p62, acidic domain, PH domain, DNA DAMAGE, DNA REPAIR
Deposited on 2008-01-31, released 2008-04-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor IIE subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TFIIH basal transcription factor complex p62 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rnrb1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2rnrB (B:)
gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

    Sequence, based on observed residues (ATOM records): (download) 
    >2rnrB (B:)
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan