PDB entry 2rnq

View 2rnq on RCSB PDB site
Description: solution structure of the c-terminal acidic domain of tfiie alpha
Deposited on 2008-01-31, released 2008-04-01
The last revision was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor IIE subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29083 (2-63)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rnqA (A:)
    gseedeeeddefeevaddpivmvagrpfsysevsqrpelvaqmtpeekeayiamgqrmfe
    dlfe
    

    Sequence, based on observed residues (ATOM records):
    >2rnqA (A:)
    eedeeeddefeevaddpivmvagrpfsysevsqrpelvaqmtpeekeayiamgqrmfedl
    fe