PDB entry 2rno

View 2rno on RCSB PDB site
Description: solution structure of the n-terminal sap domain of sumo e3 ligases from oryza sativa
Deposited on 2008-01-30, released 2008-12-30
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative DNA-binding protein
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: OSJNBb0079L11.3, Os05g0125000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6L4L4 (6-109)
      • expression tag (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rnoA (A:)
gshmasadlvssckdklayfrikelkdilnqlglpkqgkkqdlidrvlalltdeqgqrhh
gwgrknsltkeavakivddtyrkmqiqcapdlatrshsgsdfsfrpieea