PDB entry 2rnn

View 2rnn on RCSB PDB site
Description: solution structure of the n-terminal sap domain of sumo e3 ligases from saccharomyces cerevisiae
Deposited on 2008-01-30, released 2008-12-30
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 SUMO-protein ligase SIZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIZ1, ULL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04195 (3-113)
      • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rnnA (A:)
    gshminledywedetpgpdreptnelrneveetitlmellkvselkdicrsvsfpvsgrk
    avlqdlirnflqnalvvgksdpyrvqavkflierirkneplpvykdlwnalrkg