PDB entry 2rnj

View 2rnj on RCSB PDB site
Description: NMR Structure of The S. Aureus VraR DNA Binding Domain
Class: transcription
Keywords: HTH LUXR-TYPE DOMAIN, DNA BINDING DOMAIN, Activator, Antibiotic resistance, Cytoplasm, DNA-binding, Phosphoprotein, PHOSPHORYLATION, Transcription, Transcription regulation, Two-component regulatory system
Deposited on 2008-01-09, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator protein vraR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vraR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rnja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rnjA (A:)
    gsshhhhhhssglvprgshmkkraelyemlteremeillliakgysnqeiasashitikt
    vkthvsnilsklevqdrtqaviyafqhnliq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rnjA (A:)
    elyemlteremeillliakgysnqeiasashitiktvkthvsnilsklevqdrtqaviya
    fqhnliq