PDB entry 2rng

View 2rng on RCSB PDB site
Description: solution structure of big defensin
Deposited on 2007-12-27, released 2008-10-14
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Big defensin
    Species: Tachypleus tridentatus [TaxId:6853]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rngA (A:)
    nplipaiyigatvgpsvwaylvalvgaaavtaanirrassdnhscagnrgwcrskcfrhe
    yvdtyysavcgryfccrsr