PDB entry 2rnf
View 2rnf on RCSB PDB site
Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)
Class: hydrolase
Keywords: ribonuclease, hydrolase, phosphodiesterase
Deposited on
1998-11-03, released
1999-11-10
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2rnfa_ - Chain 'B':
Compound: ribonuclease 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2rnfb_ - Heterogens: UM3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2rnfA (A:)
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2rnfB (B:)
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg