PDB entry 2rnf

View 2rnf on RCSB PDB site
Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)
Deposited on 1998-11-03, released 1999-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2rnfa_
  • Chain 'B':
    Domains in SCOP 1.55: d2rnfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rnfA (A:)
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rnfB (B:)
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg