PDB entry 2rnf

View 2rnf on RCSB PDB site
Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)
Class: hydrolase
Keywords: ribonuclease, hydrolase, phosphodiesterase
Deposited on 1998-11-03, released 1999-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rnfa_
  • Chain 'B':
    Compound: ribonuclease 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rnfb_
  • Heterogens: UM3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rnfA (A:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rnfB (B:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg