PDB entry 2rn9

View 2rn9 on RCSB PDB site
Description: solution structure of human apocox17
Deposited on 2007-12-08, released 2007-12-18
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase copper chaperone
    Species: Homo sapiens [TaxId:9606]
    Gene: COX17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14061 (4-66)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rn9A (A:)
    gsftmpglvdsnpappesqekkplkpccacpetkkardaciiekgeehcghlieahkecm
    ralgfki