PDB entry 2rn8

View 2rn8 on RCSB PDB site
Description: NMR structure note: murine Itk SH3 domain
Class: Transferase
Keywords: Itk, SH3, beta barrel, 310 helix, regulatory, ATP-binding, Kinase, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Zinc, Zinc-finger
Deposited on 2007-12-08, released 2007-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase ITK/TSK
  Species: Mus musculus [TaxId:10090]
  Gene: Itk, Emt, Tlk, Tsk
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03526 (2-63)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d2rn8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rn8A (A:)
  gspeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
  kspn