PDB entry 2rn2

View 2rn2 on RCSB PDB site
Description: structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1992-04-15, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease H
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7Y4 (0-154)
  Domains in SCOPe 2.07: d2rn2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rn2A (A:)
  mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
  ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
  vkghaghpenercdelaraaamnptledtgyqvev