PDB entry 2rms

View 2rms on RCSB PDB site
Description: Solution structure of the mSin3A PAH1-SAP25 SID complex
Class: transcription
Keywords: Protein/Protein interaction, PAH domain, SIN3 corepressor, Transcription repression, Transcription regulation
Deposited on 2007-11-14, released 2008-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paired amphipathic helix protein Sin3a
    Species: Mus musculus [TaxId:10090]
    Gene: Sin3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rmsa_
  • Chain 'B':
    Compound: MSin3A-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: Sap25
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmsA (A:)
    qrlkvedalsyldqvklqfgsqpqvyndfldimkefksqsidtpgvisrvsqlfkghpdl
    imgfntflppg
    

  • Chain 'B':
    No sequence available.