PDB entry 2rmp

View 2rmp on RCSB PDB site
Description: RMP-pepstatin A complex
Class: hydrolase/hydrolase inhibitor
Keywords: ASPARTIC PROTEINASE, PEPSTATIN A, ASPARTYL PROTEASE-PEPTIDE complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1997-05-30, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mucoropepsin
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmpa_
  • Chain 'B':
    Compound: pepstatin
    Species: Streptomyces [TaxId:1883]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RMP (0-5)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rmpA (A:)
    aaadgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgs
    rffdpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptae
    qspnadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtg
    evvfggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgt
    nffimpssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisv
    pvskmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rmpA (A:)
    dgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrff
    dpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptaeqsp
    nadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevv
    fggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnff
    impssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvs
    kmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene
    

  • Chain 'B':
    No sequence available.