PDB entry 2rmo

View 2rmo on RCSB PDB site
Description: Solution structure of alpha-spectrin_SH3-bergerac from Chicken
Class: signaling protein
Keywords: SH3, Bergerac, Actin capping, Actin-binding, Calcium, Calmodulin-binding, Cytoplasm, Cytoskeleton, Membrane, Phosphorylation, SH3 domain, SIGNALING PROTEIN
Deposited on 2007-11-07, released 2008-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: sha
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (1-69)
      • initiating methionine (0)
      • see remark 999 (46-55)
    Domains in SCOPe 2.05: d2rmoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rmoA (A:)
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkatangktyerqgf
vpaayvkkld